PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00058.1.g01870.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 149aa    MW: 17305 Da    PI: 9.3918
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00058.1.g01870.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.97.4e-251058250
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  rien   rqvtf+kRr g+lKKA ELS+LCda++ vi+fs++gk+ye +
  Zjn_sc00058.1.g01870.1.sm.mk 10 RIENPVHRQVTFCKRRMGMLKKARELSILCDADIGVIVFSPNGKIYELA 58
                                  8*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.058161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.55E-28176IPR002100Transcription factor, MADS-box
CDDcd002654.81E-36273No hitNo description
PRINTSPR004043.9E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.3E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGMLK KARELSILCD ADIGVIVFSP NGKIYELATN  60
GNMQGLIERY RSTYTEKQGE SSEQDKSQFR IQIMYKEIEM LRSKEGILKA SNDILQERIM  120
QQNGILDVSG NFIMPQVPYQ LAMESDNYF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761317e-64EU976131.1 Zea mays clone 645550 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.15e-69PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK92e-49MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-49MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0E0P9N04e-72A0A0E0P9N0_ORYRU; Uncharacterized protein
STRINGSi012632m2e-68(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.14e-41AGAMOUS-like 12